Create a Link Farm
Mon, 06/25/2007 - 01:31 — cactus
You have a site that you really want to push. So you want to create a link farm? Well, here's an idea...
Your best bet might be to buy a bunch of .info domain names from a certain registrar for only 99 cents. Make sure they are related to your initial domain. (Don't buy anything that screams spam, like thisisthecoolestdomainnameitwillhelpmymainsite.info From there, if you don't already have a server (shared or dedicated), get something like bluehost and start setting them up. Add some content, and put a link on each page of each site to your main site you want to promote. The rest is up to you.
Oh, and never do a "link swap" with someone who runs a .info site. :)
- Comment
- 936 reads
User login
Menu
Who's online
There are currently 1 user and 2 guests online.
Online users
- jakpogjijvkhen
Latest Articles
Powered by Drupal - Design by Artinet - © 2007 SEO Cactus











