Create a Link Farm


You have a site that you really want to push. So you want to create a link farm? Well, here's an idea...

Your best bet might be to buy a bunch of .info domain names from a certain registrar for only 99 cents. Make sure they are related to your initial domain. (Don't buy anything that screams spam, like thisisthecoolestdomainnameitwillhelpmymainsite.info From there, if you don't already have a server (shared or dedicated), get something like bluehost and start setting them up. Add some content, and put a link on each page of each site to your main site you want to promote. The rest is up to you.

Oh, and never do a "link swap" with someone who runs a .info site. :)


User login

Who's online

There are currently 0 users and 0 guests online.

Latest Articles

Powered by Drupal - Design by Artinet - © 2007 SEO Cactus